Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella boydii serotype 4 Cobalamin synthase (cobS)

This Recombinant Shigella boydii serotype 4 Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q322B3

Expression Region

1-247

Origin

Shigella boydii serotype 4 (strain Sb227)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWAMLSFITRLPVPRRWSQGLDFEHYSRGIITFPLIGLLLGAISGLVFMVLQAWCG VPLAALFSVLVLALMTGGFHLDGLADTCDGVFSARSRDRMLEIMRDSRLGTHGGLALIFV VLAKILVLSELALRGEPILALLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQ TCVTLGLAAIFAAVLLPGMHGVAAMVVTMVAIFILGQLLKRTLGGQTGDTLGAAIELGEL VFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UACA / Nucling (AE-5), CF740 conjugate, 0.1mg/mL
BNC740956-500 1x 500 µL

UACA / Nucling (AE-5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LZTFL1 Rabbit Polyclonal Antibody
TA369198 100 µL

LZTFL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS504621 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
2-(9H-Carbazol-1-yl)acetic Acid
TRC-C178898-10MG 10 mg

2-(9H-Carbazol-1-yl)acetic Acid

Sign In for Pricing
View Details
Secnidazole-d3
TRC-S225003-25MG 25 mg

Secnidazole-d3

Sign In for Pricing
View Details
Human ZNF804A activation kit by CRISPRa
GA114151 1 Kit

Human ZNF804A activation kit by CRISPRa

Sign In for Pricing
View Details