Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella boydii serotype 4 Cobalamin synthase (cobS)

This Recombinant Shigella boydii serotype 4 Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q322B3

Expression Region

1-247

Origin

Shigella boydii serotype 4 (strain Sb227)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWAMLSFITRLPVPRRWSQGLDFEHYSRGIITFPLIGLLLGAISGLVFMVLQAWCG VPLAALFSVLVLALMTGGFHLDGLADTCDGVFSARSRDRMLEIMRDSRLGTHGGLALIFV VLAKILVLSELALRGEPILALLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQ TCVTLGLAAIFAAVLLPGMHGVAAMVVTMVAIFILGQLLKRTLGGQTGDTLGAAIELGEL VFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium 16-Hydroxyhexadecanoate-13C16
TRC-S398358-10MG 10 mg

Sodium 16-Hydroxyhexadecanoate-13C16

Sign In for Pricing
View Details
Tmem185a Mouse Gene Knockout Kit (CRISPR)
KN502023 1 Kit

Tmem185a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human KCNRG activation kit by CRISPRa
GA117035 1 Kit

Human KCNRG activation kit by CRISPRa

Sign In for Pricing
View Details
HIST1H2AH (N-term) Rabbit Polyclonal Antibody
AP18046PU-N 400 µL

HIST1H2AH (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR560181 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
CD4 Human Gene Knockout Kit (CRISPR)
KN206453BN 1 Kit

CD4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details