Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudendoclonium akinetum ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Pseudendoclonium akinetum ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

Q3ZIZ6

Expression Region

1-247

Origin

Pseudendoclonium akinetum (Green alga)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVDKIMNSTANLLFDFAEVSVGQHYYWQIGEYSVHGQVLMTSWFVFAVIAILSIAGNRDL KAIPEGLQNLTEYITEFIRDLAKTQIGEEEYVKWIPFLGTLFLFIFVSNWSGALIPWHIF EIPNGELAAPTNDINTTVALALLTSTAYFYAGFSKKGLGYFKRYVSPAAFLLPINVLEDF TKPLSLSFRLFGNILADELVVGVLVALVPLVVPIPIMLLGLFTSGIQALVFATLAGAYIG ESIEDHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Allantoin-13C2,15N4
TRC-A540502-1MG 1 mg

Allantoin-13C2,15N4

Sign In for Pricing
View Details
PTGR2 Antibody
KC-28281-01 50 μL

PTGR2 Antibody

Sign In for Pricing
View Details
PTGR2 Antibody
KC-28281-02 100 µL

PTGR2 Antibody

Sign In for Pricing
View Details
PTGR2 Antibody
KC-28281-03 1 mL

PTGR2 Antibody

Sign In for Pricing
View Details
hnRNP Q (SYNCRIP) (NM_001159673) Human Over-expression Lysate
LC431415 20 µg

hnRNP Q (SYNCRIP) (NM_001159673) Human Over-expression Lysate

Sign In for Pricing
View Details
ADAM29 (NM_001130703) Human Over-expression Lysate
LY427252 100 µg

ADAM29 (NM_001130703) Human Over-expression Lysate

Sign In for Pricing
View Details