Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella sonnei Cobalamin synthase (cobS)

This Recombinant Shigella sonnei Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q3Z0K3

Expression Region

1-247

Origin

Shigella sonnei (strain Ss046)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWAMLSFITRLPVPRRWSQGLDFEHYSRGIITFPLIGLLLGAISGLVFMVLQAWCG VPLAALFSVLVLALMTGGFHLDGLADTCDGVFSARSRDRMLEIMRDSRLGTHGGLALIFV VLAKILVLSELALRGEPILASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQ TCVTLGLAAIFAAVLLPGMHGVAAMVVTMVAIFILGQLLKRTLGGQTGDTLGAAIELGEL VFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

QK1 (QKI) (NM_006775) Human Over-expression Lysate
LY402025 100 µg

QK1 (QKI) (NM_006775) Human Over-expression Lysate

Sign In for Pricing
View Details
THUMPD3 (NM_001114092) Human Recombinant Protein
TP325871M 100 µg

THUMPD3 (NM_001114092) Human Recombinant Protein

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD90 Antibody[M5/49.4.1]
E-AB-F1283M1-01 50 Tests

Elab Fluor® 700 Anti-Mouse CD90 Antibody[M5/49.4.1]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD90 Antibody[M5/49.4.1]
E-AB-F1283M1-02 100 Tests

Elab Fluor® 700 Anti-Mouse CD90 Antibody[M5/49.4.1]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD90 Antibody[M5/49.4.1]
E-AB-F1283M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Mouse CD90 Antibody[M5/49.4.1]

Sign In for Pricing
View Details
2-Nitrobenzylcyanide
TRC-N495425-5G 5 g

2-Nitrobenzylcyanide

Sign In for Pricing
View Details