Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella sonnei Cobalamin synthase (cobS)

This Recombinant Shigella sonnei Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q3Z0K3

Expression Region

1-247

Origin

Shigella sonnei (strain Ss046)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWAMLSFITRLPVPRRWSQGLDFEHYSRGIITFPLIGLLLGAISGLVFMVLQAWCG VPLAALFSVLVLALMTGGFHLDGLADTCDGVFSARSRDRMLEIMRDSRLGTHGGLALIFV VLAKILVLSELALRGEPILASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQ TCVTLGLAAIFAAVLLPGMHGVAAMVVTMVAIFILGQLLKRTLGGQTGDTLGAAIELGEL VFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD79b (B-Cell Marker) (B29/123), CF568 conjugate, 0.1mg/mL
BNC683107-100 1x 100 µL

CD79b (B-Cell Marker) (B29/123), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Biotin Conjugated Triticum vulgare Lectin (Wheat Germ) -WGA-
BA-2101-5 5 mg

Biotin Conjugated Triticum vulgare Lectin (Wheat Germ) -WGA-

Sign In for Pricing
View Details
Human MCSF Antibody Pair Set
E-KAB-0267 50 µL & 100 µg

Human MCSF Antibody Pair Set

Sign In for Pricing
View Details
CYP2C18 Rabbit Polyclonal Antibody
TA375284 100 µL

CYP2C18 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Tubulin,  5nm
GM-35-5 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Tubulin, 5nm

Sign In for Pricing
View Details
CEBP Alpha (CEBPA) Rabbit Polyclonal Antibody
AP06373PU-N 100 µg

CEBP Alpha (CEBPA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details