Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acorus americanus ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Acorus americanus ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

Q4FGF8

Expression Region

1-247

Origin

Acorus americanus (Sweetflag)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVILCSSNMLKGLYDISGVEVGQHLYWQIGGFQVHAQVLITSWVVIAILLGSVTVAVRN PQTIPTNGQNFFEYVLEFIRDLSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKLI ELPHGELAAPTNDINTTVALALPTSVAYFYAGLTKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Liver
CS800903 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details
Tissue FFPE Sections, Esophagus
CS713881 5x 5 µm

Tissue FFPE Sections, Esophagus

Sign In for Pricing
View Details
DNA Polymerase lambda Recombinant Rabbit monoclonal Antibody
HA750995 100 µL

DNA Polymerase lambda Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Mouse Complement Factor B (CFB) ELISA Kit
RD-CFB-Mu-01 96 Tests

Mouse Complement Factor B (CFB) ELISA Kit

Sign In for Pricing
View Details
Mouse Complement Factor B (CFB) ELISA Kit
RD-CFB-Mu-02 48 Tests

Mouse Complement Factor B (CFB) ELISA Kit

Sign In for Pricing
View Details
Parathyroid hormone related protein (PTHLH) Rabbit Polyclonal Antibody
TA364192 50 µL

Parathyroid hormone related protein (PTHLH) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details