Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactuca sativa ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Lactuca sativa ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

Q56P09

Expression Region

1-247

Origin

Lactuca sativa (Garden lettuce)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVLSCSINTLNGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLASATLAVRN PQTIPTSGQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSVAYFYAGLSKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FAM78B activation kit by CRISPRa
GA115703 1 Kit

Human FAM78B activation kit by CRISPRa

Sign In for Pricing
View Details
PACS1 Antibody
KC-34355-01 50 μL

PACS1 Antibody

Sign In for Pricing
View Details
PACS1 Antibody
KC-34355-02 100 µL

PACS1 Antibody

Sign In for Pricing
View Details
PACS1 Antibody
KC-34355-03 1 mL

PACS1 Antibody

Sign In for Pricing
View Details
LSM1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5C6]
TA503120BM 100 µL

LSM1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5C6]

Sign In for Pricing
View Details
Rgs1 Mouse Gene Knockout Kit (CRISPR)
KN514726 1 Kit

Rgs1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details