Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Panax ginseng ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Panax ginseng ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

Q68S18

Expression Region

1-247

Origin

Panax ginseng (Korean ginseng)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN PQTIPTGGQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGDILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pTR-Luc-HYG-GFP
LR-2073G 2 µg

pTR-Luc-HYG-GFP

Sign In for Pricing
View Details
Olfr744 Mouse qPCR Primer Pair (NM_001011738)
MP210176 200 Reactions

Olfr744 Mouse qPCR Primer Pair (NM_001011738)

Sign In for Pricing
View Details
Axl Rabbit mAb
E60M0745 100 µL

Axl Rabbit mAb

Sign In for Pricing
View Details
Matrix Metalloproteinase 13 (MMP-13/Collagenase 3) Monkey ELISA Kit
F0620 96 Tests

Matrix Metalloproteinase 13 (MMP-13/Collagenase 3) Monkey ELISA Kit

Sign In for Pricing
View Details
SNX3 Protein Vector (Human) (pPM-C-His)
PV039508 500 ng

SNX3 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
SPINT2 Protein Vector (Rat) (pPB-C-His)
PV307806 500 ng

SPINT2 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details