Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Panax ginseng ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Panax ginseng ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

Q68S18

Expression Region

1-247

Origin

Panax ginseng (Korean ginseng)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN PQTIPTGGQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGDILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GDI2P2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV726567 1.0 µg DNA

GDI2P2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
ATP2A3 Blocking Peptide
33R-5064 0.1 mg

ATP2A3 Blocking Peptide

Sign In for Pricing
View Details
Human VCP-like protein Recombinant Protein C-6 His Tag 50UG
IHUVCPPRC6HIS50UG 50 µg

Human VCP-like protein Recombinant Protein C-6 His Tag 50UG

Sign In for Pricing
View Details
SPAG4L (SUN5) Human shRNA Plasmid Kit (Locus ID 140732)
TL301443 1 Kit

SPAG4L (SUN5) Human shRNA Plasmid Kit (Locus ID 140732)

Sign In for Pricing
View Details
GUSBP8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV727177 1.0 µg DNA

GUSBP8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
PAFAH1B1 Antibody, FITC conjugated
MBS7048824-01 0.05 mg

PAFAH1B1 Antibody, FITC conjugated

Sign In for Pricing
View Details