Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Panax ginseng ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Panax ginseng ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

Q68S18

Expression Region

1-247

Origin

Panax ginseng (Korean ginseng)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN PQTIPTGGQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGDILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal gamma Catenin Antibody (CTNG/1664) [Janelia Fluor 549]
NBP2-54524JF549 0.1 mL

Mouse Monoclonal gamma Catenin Antibody (CTNG/1664) [Janelia Fluor 549]

Sign In for Pricing
View Details
Rabbit anti-THOC5 IHC Antibody, Affinity Purified
IHC-00563 25 µg

Rabbit anti-THOC5 IHC Antibody, Affinity Purified

Sign In for Pricing
View Details
UNC45B Protein Vector (Mouse) (pPB-N-His)
PV244171 500 ng

UNC45B Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Phospho-FLG (Tyr766) Polyclonal Antibody, PE-Cy7 Conjugated
bs-3136R-PE-Cy7 100 µL

Phospho-FLG (Tyr766) Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Cynomolgus / Rhesus macaque TPBG Protein, His Tag
orb867329-01 100 µg

Cynomolgus / Rhesus macaque TPBG Protein, His Tag

Sign In for Pricing
View Details
Cynomolgus / Rhesus macaque TPBG Protein, His Tag
orb867329-02 1 mg

Cynomolgus / Rhesus macaque TPBG Protein, His Tag

Sign In for Pricing
View Details