Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sulfolobus tokodaii Cobalamin synthase (cobS)

This Recombinant Sulfolobus tokodaii Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q96Y25

Expression Region

1-247

Origin

Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKIFKKIASQISFFTIIPSTKATLEEVASASFISPIIIGVITALIDYSVVFVTSKFLGNL AFLLLLPTVEIIRGFHHLDGLLDFGDALMAKDYNKKIKALHDVEVGAGGIGLLLVYVSIF LTVLLSIKTLSFYSLLIAEVESRALGILLLAIMPPIEISYMGKIFHKNLNNKWKILSIIV EVVLFGNPYILISFAILLLFFYFLGYSTLKGSSGDFIGAIITLSFPIFLLIAERSCYLFF TSLFSLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 (ICO-115), CF647 conjugate, 0.1mg/mL
BNC470039-100 1x 100 µL

CD34 (ICO-115), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL
BNC880253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL
BNC400460-500 1x 500 µL

CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2123R), CF640R conjugate, 0.1mg/mL
BNC402123-500 1x 500 µL

Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2123R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL
BNC470253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF568 conjugate, 0.1mg/mL
BNC680218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details