Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a, chloroplastic (atpI)

This Recombinant ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

Q9MUS9

Expression Region

1-247

Origin

Mesostigma viride

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINPSSMENFNMLYQLSKVEVGQHFYWQIGDFEVHGQVLLVSWFVMTIIISLSIFGTRNL QTIPTGTQNFVEYVLEFIRDLAKTQIGEEDYRSWVPFIGTIFLFIFVSNWSGALVPWKLI EIPNGELAAPTNDINTTAALALLTSISYFYAGFSKKGLRYFKRYISPTPVLLPINLLEDF TKPLSLSFRLFGNILADELVVGVLITLVPLVVPMPLMLLGLFTSAIQALIFATLAAAYIG EAVEDHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Capns1 activation kit by CRISPRa
GA200515 1 Kit

Mouse Capns1 activation kit by CRISPRa

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Ligand Superfamily, Member 9 (TNFSF9) ELISA Kit
RD-TNFSF9-Hu-01 96 Tests

Human Tumor Necrosis Factor Ligand Superfamily, Member 9 (TNFSF9) ELISA Kit

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Ligand Superfamily, Member 9 (TNFSF9) ELISA Kit
RD-TNFSF9-Hu-02 48 Tests

Human Tumor Necrosis Factor Ligand Superfamily, Member 9 (TNFSF9) ELISA Kit

Sign In for Pricing
View Details
Relaxin 1 (RLN1) Rabbit Polyclonal Antibody
TA380948 100 µL

Relaxin 1 (RLN1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Syntaxin 3 (STX3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A5]
TA811076BM 100 µL

Syntaxin 3 (STX3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A5]

Sign In for Pricing
View Details
2-Ethylbenzene-1,4-diol
TRC-E899860-500MG 500 mg

2-Ethylbenzene-1,4-diol

Sign In for Pricing
View Details