Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a, chloroplastic (atpI)

This Recombinant ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

Q9MUS9

Expression Region

1-247

Origin

Mesostigma viride

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINPSSMENFNMLYQLSKVEVGQHFYWQIGDFEVHGQVLLVSWFVMTIIISLSIFGTRNL QTIPTGTQNFVEYVLEFIRDLAKTQIGEEDYRSWVPFIGTIFLFIFVSNWSGALVPWKLI EIPNGELAAPTNDINTTAALALLTSISYFYAGFSKKGLRYFKRYISPTPVLLPINLLEDF TKPLSLSFRLFGNILADELVVGVLITLVPLVVPMPLMLLGLFTSAIQALIFATLAAAYIG EAVEDHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1758), CF568 conjugate, 0.1mg/mL
BNC681758-500 1x 500 µL

CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1758), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Anti-FAA
Y123010 100 µL

Anti-FAA

Sign In for Pricing
View Details
Prohibitin Recombinant Rabbit monoclonal Antibody
HA750043 100 µL

Prohibitin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
ZFP37 Mouse Monoclonal Antibody [Clone ID: OTI3E7]
CF810209 100 µg

ZFP37 Mouse Monoclonal Antibody [Clone ID: OTI3E7]

Sign In for Pricing
View Details
RET (C-term) Rabbit Polyclonal Antibody
AP14411PU-N 400 µL

RET (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TCL1 (T-Cell Marker) (TCL1/2078), CF594 conjugate, 0.1mg/mL
BNC942078-500 1x 500 µL

TCL1 (T-Cell Marker) (TCL1/2078), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details