Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oenothera elata subsp. hookeri ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Oenothera elata subsp. hookeri ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

Q9MTM0

Expression Region

1-247

Origin

Oenothera elata subsp. hookeri (Hooker's evening primrose) (Oenothera hookeri)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDVLSCSNNTLKGLYDISGVEVGQHFYWQIGGFQVHGQVLITSWVVIAILLGSASIAVRN PQTIPNDSQNFFEYILEFIRDVSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKLV ELPHGELAAPTNDINTTVALALLTSVAYFYAGLSKKGLGYFSKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p16INK4A (CDKN2A) Mouse Monoclonal Antibody [Clone ID: OTI11D3]
CF809881 100 µg

p16INK4A (CDKN2A) Mouse Monoclonal Antibody [Clone ID: OTI11D3]

Sign In for Pricing
View Details
Recombinant MERS-CoV Nucleocapsid Protein
PKSV030288-01 50 µg

Recombinant MERS-CoV Nucleocapsid Protein

Sign In for Pricing
View Details
Recombinant MERS-CoV Nucleocapsid Protein
PKSV030288-02 500 µg

Recombinant MERS-CoV Nucleocapsid Protein

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike Protein (RBD, mFc Tag)
PKSR030474-01 50 µg

Recombinant SARS-CoV-2 Spike Protein (RBD, mFc Tag)

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike Protein (RBD, mFc Tag)
PKSR030474-02 1 mg

Recombinant SARS-CoV-2 Spike Protein (RBD, mFc Tag)

Sign In for Pricing
View Details
Glutathione Peroxidase 7 (GPX7) (NM_015696) Human Recombinant Protein
TP307428M 100 µg

Glutathione Peroxidase 7 (GPX7) (NM_015696) Human Recombinant Protein

Sign In for Pricing
View Details