Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oryza sativa ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Oryza sativa ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

P0C2Y5

Expression Region

1-247

Origin

Oryza sativa (Rice)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNIIPCSIKTLKGLYDISGVEVGQHFYWQIGGFQIHAQVLITSWVVITILLGSVIIAVRN PQTIPTDGQNFFEYVLEFIRDLSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSAAYFYAGLSKKGLSYFEKYIKPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anoctamin 3 (ANO3) Human Gene Knockout Kit (CRISPR)
KN423382 1 Kit

Anoctamin 3 (ANO3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ror2 Mouse Gene Knockout Kit (CRISPR)
KN314985 1 Kit

Ror2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N-Formyl-L-phenylalanine
TRC-F700698-250MG 250 mg

N-Formyl-L-phenylalanine

Sign In for Pricing
View Details
Obelin (Recombinant) Photoprotein
L001C-50UG 50 µg

Obelin (Recombinant) Photoprotein

Sign In for Pricing
View Details
CBF (CEBPZ) (C-term) Rabbit Polyclonal Antibody
AP12351PU-N 400 µL

CBF (CEBPZ) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Di(p-anisyl)iodonium Bromide
TRC-D417060-2.5G 2.5 g

Di(p-anisyl)iodonium Bromide

Sign In for Pricing
View Details