Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zea mays ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Zea mays ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

P17344

Expression Region

1-247

Origin

Zea mays (Maize)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNITPCSIKTLKGLYDISGVEVGQHFYWQIGGFQIHAQVLITSWVVITILLGSVIIAVRN PQTIPTDGQNFFEYVLEFIRDLSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII ELPHGELAAPTNDINTTVALALLTSAAYFYAGLSKKGLSYFEKYIKPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycobacterium Tuberculosis Rv2084 Protein (aa 1-380)
VAng-Yyj0700-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Tuberculosis Rv2084 Protein (aa 1-380)

Sign In for Pricing
View Details
XIAP ELISA Kit (Human) (OKCD00340)
OKCD00340 96 Well

XIAP ELISA Kit (Human) (OKCD00340)

Sign In for Pricing
View Details
AMPK alpha2, CT (5'-AMP-activated Protein Kinase, Catalytic alpha-2, AMPK Subunit alpha-2, PRKAA2, AMPK, AMPK2) (PE) discontinued
A1475-02D-PE 200 µL

AMPK alpha2, CT (5'-AMP-activated Protein Kinase, Catalytic alpha-2, AMPK Subunit alpha-2, PRKAA2, AMPK, AMPK2) (PE) discontinued

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Cluster Of Differentiation 55 (CD55)
MBS2166430-01 0.1 mL

Cy3-Linked Monoclonal Antibody to Cluster Of Differentiation 55 (CD55)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Cluster Of Differentiation 55 (CD55)
MBS2166430-02 0.2 mL

Cy3-Linked Monoclonal Antibody to Cluster Of Differentiation 55 (CD55)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Cluster Of Differentiation 55 (CD55)
MBS2166430-03 0.5 mL

Cy3-Linked Monoclonal Antibody to Cluster Of Differentiation 55 (CD55)

Sign In for Pricing
View Details