Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zea mays ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Zea mays ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

P17344

Expression Region

1-247

Origin

Zea mays (Maize)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNITPCSIKTLKGLYDISGVEVGQHFYWQIGGFQIHAQVLITSWVVITILLGSVIIAVRN PQTIPTDGQNFFEYVLEFIRDLSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII ELPHGELAAPTNDINTTVALALLTSAAYFYAGLSKKGLSYFEKYIKPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Cytokeratin 7 Antibody
CPA9151-01 30 µL

Anti-Cytokeratin 7 Antibody

Sign In for Pricing
View Details
Anti-Cytokeratin 7 Antibody
CPA9151-02 50 μL

Anti-Cytokeratin 7 Antibody

Sign In for Pricing
View Details
Anti-Cytokeratin 7 Antibody
CPA9151-03 100 µL

Anti-Cytokeratin 7 Antibody

Sign In for Pricing
View Details
Anti-Cytokeratin 7 Antibody
CPA9151-04 200 µL

Anti-Cytokeratin 7 Antibody

Sign In for Pricing
View Details
Mouse Transglutaminase 4, Prostate ELISA Kit
MBS101899-01 48 Well

Mouse Transglutaminase 4, Prostate ELISA Kit

Sign In for Pricing
View Details
Mouse Transglutaminase 4, Prostate ELISA Kit
MBS101899-02 96 Well

Mouse Transglutaminase 4, Prostate ELISA Kit

Sign In for Pricing
View Details