Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a, chloroplastic (atpI)

This Recombinant ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

P51247

Expression Region

1-248

Origin

Porphyra purpurea

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYQNNLIDFNPYSCLSAVEVGKHLYWKIGSLQLHGQVFIVSWLVIAALLTISFLGTRNLQ RIPEKFQNFMEFILEFLQDIAKNQIGEHEYRPWVPYIATLFLFILGCNWAGALIPWKLIH LPEGELAAPTNDINTTVALSLLTSLAYFYAGLSKKGLGYFARYVQPTPVLLPINILEDFT KPLSLSFRLFGNVLADELVVSVFTLLIPILIPLPVMILGLFASSIQALIFSTLSAAYIGE AMEGHGEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100 alpha6 Antibody
KC-6334-01 50 μL

S100 alpha6 Antibody

Sign In for Pricing
View Details
S100 alpha6 Antibody
KC-6334-02 100 µL

S100 alpha6 Antibody

Sign In for Pricing
View Details
S100 alpha6 Antibody
KC-6334-03 1 mL

S100 alpha6 Antibody

Sign In for Pricing
View Details
Cytokeratin 8/18 (KRT8/803 + KRT18/835), CF594 conjugate, 0.1mg/mL
BNC940979-100 1x 100 µL

Cytokeratin 8/18 (KRT8/803 + KRT18/835), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Dextrosimendan 6-Phenyl
TRC-L589170-25MG 25 mg

Dextrosimendan 6-Phenyl

Sign In for Pricing
View Details
PRAMEF14 (NM_001099854) Human Over-expression Lysate
LY420543 100 µg

PRAMEF14 (NM_001099854) Human Over-expression Lysate

Sign In for Pricing
View Details