Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a, chloroplastic (atpI)

This Recombinant ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

P51247

Expression Region

1-248

Origin

Porphyra purpurea

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYQNNLIDFNPYSCLSAVEVGKHLYWKIGSLQLHGQVFIVSWLVIAALLTISFLGTRNLQ RIPEKFQNFMEFILEFLQDIAKNQIGEHEYRPWVPYIATLFLFILGCNWAGALIPWKLIH LPEGELAAPTNDINTTVALSLLTSLAYFYAGLSKKGLGYFARYVQPTPVLLPINILEDFT KPLSLSFRLFGNVLADELVVSVFTLLIPILIPLPVMILGLFASSIQALIFSTLSAAYIGE AMEGHGEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SGT1 (ECD) (NM_001135752) Human Over-expression Lysate
LY427697 100 µg

SGT1 (ECD) (NM_001135752) Human Over-expression Lysate

Sign In for Pricing
View Details
PI3-kinase p110 subunit beta Recombinant Rabbit Monoclonal Antibody [SC0580]
ET1610-36 100 µL

PI3-kinase p110 subunit beta Recombinant Rabbit Monoclonal Antibody [SC0580]

Sign In for Pricing
View Details
NRIP3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G6]
TA504921AM 100 µL

NRIP3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G6]

Sign In for Pricing
View Details
Wilm s Tumor 1 (WT1) (Wilm s Tumor & Mesothelial Marker) (rWT1/857), 0.2mg/mL
BNUB1856-100 1x 100 µL

Wilm s Tumor 1 (WT1) (Wilm s Tumor & Mesothelial Marker) (rWT1/857), 0.2mg/mL

Sign In for Pricing
View Details
FOXA1 Rabbit Polyclonal Antibody
TA384247 100 µL

FOXA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IFNA2 Antibody (HRP)
KH-2879-01 50 μL

IFNA2 Antibody (HRP)

Sign In for Pricing
View Details