Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Marchantia polymorpha ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Marchantia polymorpha ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

P06289

Expression Region

1-248

Origin

Marchantia polymorpha (Liverwort) (Marchantia aquatica)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSHTAKMASTFNNFYEISNVEVGQHFYWQLGSFQVHAQVLITSWIVIAILLSLAVLATRN LQTIPMGGQNFVEYVLEFIRDLTRTQIGEEEYRPWVPFIGTMFLFIFVSNWSGALFPWRV FELPNGELAAPTNDINTTVALALLTSVAYFYAGLHKKGLSYFGKYIQPTPVLLPINILED FTKPLSLSFRLFGNILADELVVAVLISLVPLVVPIPMMFLGLFTSAIQALIFATLAAAYI GESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

beta Tubulin Mouse Monoclonal Antibody [1-B11]
EM0103 100 µL

beta Tubulin Mouse Monoclonal Antibody [1-B11]

Sign In for Pricing
View Details
MIF Human Gene Knockout Kit (CRISPR)
KN205106RB 1 Kit

MIF Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Naloxone Hydrochloride
TRC-N285000-250MG 250 mg

Naloxone Hydrochloride

Sign In for Pricing
View Details
CD4 Mouse Monoclonal Antibody (SK3), CF®660C Conjugate - Biotium Choice
P001-660C-125 1x 125 µL

CD4 Mouse Monoclonal Antibody (SK3), CF®660C Conjugate - Biotium Choice

Sign In for Pricing
View Details
ZIK1 (NM_001010879) Human Over-expression Lysate
LY423204 100 µg

ZIK1 (NM_001010879) Human Over-expression Lysate

Sign In for Pricing
View Details
MAP4K2 Polyclonal Antibody
E-AB-10897-01 20 µL

MAP4K2 Polyclonal Antibody

Sign In for Pricing
View Details