Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Marchantia polymorpha ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Marchantia polymorpha ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

P06289

Expression Region

1-248

Origin

Marchantia polymorpha (Liverwort) (Marchantia aquatica)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSHTAKMASTFNNFYEISNVEVGQHFYWQLGSFQVHAQVLITSWIVIAILLSLAVLATRN LQTIPMGGQNFVEYVLEFIRDLTRTQIGEEEYRPWVPFIGTMFLFIFVSNWSGALFPWRV FELPNGELAAPTNDINTTVALALLTSVAYFYAGLHKKGLSYFGKYIQPTPVLLPINILED FTKPLSLSFRLFGNILADELVVAVLISLVPLVVPIPMMFLGLFTSAIQALIFATLAAAYI GESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

iNOS (NOS2) Rabbit Polyclonal Antibody
AP06181PU-N 100 µg

iNOS (NOS2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human CD97 Protein (His Tag)
PKSH031169 100 µg

Recombinant Human CD97 Protein (His Tag)

Sign In for Pricing
View Details
Anti-Mouse CD40 (FGK4.5) In Vivo Antibody - Low Endotoxin
ICH1073-25mg 25 mg

Anti-Mouse CD40 (FGK4.5) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
Frozen Tissue Sections, Lymphoid tissue
CS623259 5x 5 µm

Frozen Tissue Sections, Lymphoid tissue

Sign In for Pricing
View Details
IL17F Human
OM296468-01 25 µg

IL17F Human

Sign In for Pricing
View Details
IL17F Human
OM296468-02 5 µg

IL17F Human

Sign In for Pricing
View Details