Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Syntrophobacter fumaroxidans Cobalamin synthase (cobS)

This Recombinant Syntrophobacter fumaroxidans Cobalamin synthase (cobS) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A0LLI5

Expression Region

1-248

Origin

Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWSHFGTALSFLTLFRLPFTSPRTLTPQELAESFSFFPLVGLILGFCYALPARVLSGVVP SLLLAVAITALTAVLTRALHLDGLADLADGVGGGYDPERRLEIMKDSRTGAFGALAIALA VAFKVAALDAVIRAGSFLPLLLVPVVSRLAMVLAAYRSPYARKEGGLGKPFLEHIARRHL LTALGLTAVSAFLVQPVFGLCALVLAAGTVPAFRLLCRRWLGGMTGDALGALNEIVEVLL LSAAACMY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Artemin (ARTN) (NM_001136215) Human Recombinant Protein
TP761756 50 µg

Artemin (ARTN) (NM_001136215) Human Recombinant Protein

Sign In for Pricing
View Details
SAMD12 (NM_207506) Human Over-expression Lysate
LY404050 100 µg

SAMD12 (NM_207506) Human Over-expression Lysate

Sign In for Pricing
View Details
Human PWWP3B activation kit by CRISPRa
GA115332 1 Kit

Human PWWP3B activation kit by CRISPRa

Sign In for Pricing
View Details
Polystyrene C4 NH₂
HB08016002.5G 5 g

Polystyrene C4 NH₂

Sign In for Pricing
View Details
Uric Acid-1,3-15N2
TRC-U829203-50MG 50 mg

Uric Acid-1,3-15N2

Sign In for Pricing
View Details
Iobitridol (>90%)
TRC-I666700-5MG 5 mg

Iobitridol (>90%)

Sign In for Pricing
View Details