Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Syntrophobacter fumaroxidans Cobalamin synthase (cobS)

This Recombinant Syntrophobacter fumaroxidans Cobalamin synthase (cobS) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A0LLI5

Expression Region

1-248

Origin

Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWSHFGTALSFLTLFRLPFTSPRTLTPQELAESFSFFPLVGLILGFCYALPARVLSGVVP SLLLAVAITALTAVLTRALHLDGLADLADGVGGGYDPERRLEIMKDSRTGAFGALAIALA VAFKVAALDAVIRAGSFLPLLLVPVVSRLAMVLAAYRSPYARKEGGLGKPFLEHIARRHL LTALGLTAVSAFLVQPVFGLCALVLAAGTVPAFRLLCRRWLGGMTGDALGALNEIVEVLL LSAAACMY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMP3 (NM_001201) Human Over-expression Lysate
LY400482 100 µg

BMP3 (NM_001201) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Gna14 activation kit by CRISPRa
GA201647 1 Kit

Mouse Gna14 activation kit by CRISPRa

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Rat CD3 Antibody[G4.18]
E-AB-F1228UM1-01 25 µg

Elab Fluor® 700 Anti-Rat CD3 Antibody[G4.18]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Rat CD3 Antibody[G4.18]
E-AB-F1228UM1-02 100 µg

Elab Fluor® 700 Anti-Rat CD3 Antibody[G4.18]

Sign In for Pricing
View Details
Exodus 2 (CCL21) (NM_002989) Human Over-expression Lysate
LC401047 20 µg

Exodus 2 (CCL21) (NM_002989) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Appendix
CS802689 5x 5 µm

Tissue FFPE Sections, Appendix

Sign In for Pricing
View Details