Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cryptomeria japonica ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Cryptomeria japonica ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

B1VKH7

Expression Region

1-248

Origin

Cryptomeria japonica (Japanese cedar) (Cupressus japonica)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDILQFPINMLNYFYEISGVEVGQHFYWQIGGFQVHAQVLITSWIVIAVLLGSATLAVRD PQIIPNGAQNFLEYVLEFVRDLARTQIGEEEYGPWVPFIGTMFLFIFVSNWAGALFPWGI IKLPHGELAAPTNDINTTVALALLTSVAYFYAGFTKRGLGYFGKYIQPTPILLPINILED FTKPLSLSFRLFGNILADELVVAVLVSLVPIVVPIPVMFLGLFTSGIQALIFATLAAAYI GESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL
BNC680266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL
BNC740253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF405S conjugate, 0.1mg/mL
BNC040871-500 1x 500 µL

CD71 (66IG10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL
BNC740177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), Biotin conjugate, 0.1mg/mL
BNCB0994-100 1x 100 µL

TNF alpha (J2D10), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (1B4), CF568 conjugate, 0.1mg/mL
BNC681729-100 1x 100 µL

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (1B4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details