Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a, chloroplastic (atpI)

This Recombinant ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

Q1XDP0

Expression Region

1-248

Origin

Porphyra yezoensis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYQNSLIDFNPYNSLSAVEVGKHLYWKIGSLQLHGQVFIVSWLVIATLLTLSFLGTRNLQ RIPEKFQNFMEFILEFLQDIAKNQIGEHEYRPWVPYIATLFLFILGCNWAGALIPWKLIH LPEGELAAPTNDINTTVALSLLTSLAYFYAGLSKKGLGYFARYIQPTPVLLPINILEDFT KPLSLSFRLFGNVLADELVVSVFTLLIPILIPLPVMILGLFASSIQALIFSTLSAAYIGE AMEGHGEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diethanolamine AR/ACS for Biochemistry
104360 200 200 L

Diethanolamine AR/ACS for Biochemistry

Sign In for Pricing
View Details
AMOT (pY599) Antibody
abx032202-01 80 µL

AMOT (pY599) Antibody

Sign In for Pricing
View Details
AMOT (pY599) Antibody
abx032202-02 400 µL

AMOT (pY599) Antibody

Sign In for Pricing
View Details
Klk1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6750107 1.0 µg DNA

Klk1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Canine Gamma-Aminobutyric Acid (GABA) ELISA Kit
MBS2607745-01 48 Well

Canine Gamma-Aminobutyric Acid (GABA) ELISA Kit

Sign In for Pricing
View Details
Canine Gamma-Aminobutyric Acid (GABA) ELISA Kit
MBS2607745-02 96 Well

Canine Gamma-Aminobutyric Acid (GABA) ELISA Kit

Sign In for Pricing
View Details