Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a, chloroplastic (atpI)

This Recombinant ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

Q1XDP0

Expression Region

1-248

Origin

Porphyra yezoensis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYQNSLIDFNPYNSLSAVEVGKHLYWKIGSLQLHGQVFIVSWLVIATLLTLSFLGTRNLQ RIPEKFQNFMEFILEFLQDIAKNQIGEHEYRPWVPYIATLFLFILGCNWAGALIPWKLIH LPEGELAAPTNDINTTVALSLLTSLAYFYAGLSKKGLGYFARYIQPTPVLLPINILEDFT KPLSLSFRLFGNVLADELVVSVFTLLIPILIPLPVMILGLFASSIQALIFSTLSAAYIGE AMEGHGEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD86 (Activation B7-2 Antigen, B70, B7-2, BU63, CD28LG2, CTLA-4 Counter-receptor B7.2, FUN-1, LAB72, MGC34413, T-lymphocyte Activation Antigen CD86 Precursor) (FITC) discontinued
C2438-05J 100 µg

CD86 (Activation B7-2 Antigen, B70, B7-2, BU63, CD28LG2, CTLA-4 Counter-receptor B7.2, FUN-1, LAB72, MGC34413, T-lymphocyte Activation Antigen CD86 Precursor) (FITC) discontinued

Sign In for Pricing
View Details
Pack of 100 sheets of technical creped filter 160g/m², 650x1400 mm + 10 holes (folded)
FT101F65140/126C Pack of 100 Sheets

Pack of 100 sheets of technical creped filter 160g/m², 650x1400 mm + 10 holes (folded)

Sign In for Pricing
View Details
IRX6 Rabbit Polyclonal Antibody
E10G06765 100 µL

IRX6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GOT1L1 Polyclonal Antibody, HRP Conjugated
bs-13494R-HRP-TR 20 µL

GOT1L1 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
TNFRSF1A Recombinant Protein
OPCD07565-10UG 10 µg

TNFRSF1A Recombinant Protein

Sign In for Pricing
View Details
Recombinant Rat IL-7
P6281-100μg 100 µg

Recombinant Rat IL-7

Sign In for Pricing
View Details