Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staurastrum punctulatum ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Staurastrum punctulatum ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

Q32RY0

Expression Region

1-248

Origin

Staurastrum punctulatum (Green alga)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYITEASIDSYSSLYQISAVEVGQHFYWEIGDLRVHGQVLITSWVVIGILLTVAFLGTRK LETVPNATQNFVEYVLQFIRDLARTQIGEEEYRDWVPFVGTLFLFIFVSNWSGALVPWKL IELPHGELAAPTNDINTTVALALLTSGAYFYAGFHKRGLSYFGKYLQPTPVLLPINILED FTKPLSLSFRLFGNILADELVVAVLVSLVPLVVPIPMMFLGLFTSGIQALIFATLAAAYI GESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Cyclophilin B/PPIB Protein (His Tag)
PKSH033569-01 10 µg

Recombinant Human Cyclophilin B/PPIB Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Cyclophilin B/PPIB Protein (His Tag)
PKSH033569-02 50 µg

Recombinant Human Cyclophilin B/PPIB Protein (His Tag)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS501847 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Human AMY1 (Amylase Alpha 1, Salivary) CLIA Kit
E-CL-H0258-01 24 Tests

Human AMY1 (Amylase Alpha 1, Salivary) CLIA Kit

Sign In for Pricing
View Details
Human AMY1 (Amylase Alpha 1, Salivary) CLIA Kit
E-CL-H0258-02 48 Tests

Human AMY1 (Amylase Alpha 1, Salivary) CLIA Kit

Sign In for Pricing
View Details
Human AMY1 (Amylase Alpha 1, Salivary) CLIA Kit
E-CL-H0258-03 96 Tests

Human AMY1 (Amylase Alpha 1, Salivary) CLIA Kit

Sign In for Pricing
View Details