Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nuphar advena ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Nuphar advena ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

Q4FGF6

Expression Region

1-248

Origin

Nuphar advena (Common spatterdock) (Nuphar lutea subsp. advena)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVLPCSINTLKGLYEISGVEVGQHFYWQIGGFQVHAQVLITSWVVIAILLGSAAIAVRN PQTIPTDGQNFFEYVLEFIRDVSKTQIGEEEYGPWVPFIGTLFLFIFVSNWSGALLPWRI IQLPHGELAAPTNDINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPTPILLPINVLED FTKPLSLSFRLFGNILADELVVVVLVSLVPLVIPIPVMFLGLFTSGIQALIFATLAAAYI GESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Prenylcysteine oxidase 1 (PCYOX1) ELISA Kit
EK8631 48 Tests

Mouse Prenylcysteine oxidase 1 (PCYOX1) ELISA Kit

Sign In for Pricing
View Details
Lypd6b 3'UTR GFP Stable Cell Line
TU262714 1.0 mL

Lypd6b 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Research Grade Anti-Human CD123/IL3RA (UCART123)
MBS1581269-01 0.1 mg

Research Grade Anti-Human CD123/IL3RA (UCART123)

Sign In for Pricing
View Details
Research Grade Anti-Human CD123/IL3RA (UCART123)
MBS1581269-02 1 mg

Research Grade Anti-Human CD123/IL3RA (UCART123)

Sign In for Pricing
View Details
Research Grade Anti-Human CD123/IL3RA (UCART123)
MBS1581269-03 5x 1 mg

Research Grade Anti-Human CD123/IL3RA (UCART123)

Sign In for Pricing
View Details
MATR3 Polyclonal Antibody, Cy7 Conjugated
bs-5141R-Cy7 100 µL

MATR3 Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details