Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a, chloroplastic (atpI)

This Recombinant ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

Q70XU8

Expression Region

1-248

Origin

Amborella trichopoda

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVLPCSINTLKGIYDLSGVEVGQHFYWQIGGFQVHAQVLITSWVVIAILLGSATIVVRN PQTIPTDGQNFFEYVLEFIRDLTKTQIGEEEYGPWVPFIGTMFLFIFVSNWSGALLPRKI IELPQGELAAPTNDINTTVALALPTSVAYFYAGISKKGLGYFGKYIQPTPILLPINILED FTKPLSLSFRLFGNILADELVVVVLVSLVPSLVPIPVMFLGLFTSGIQALIFATLAAAYI GESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WASF2 Rabbit Monoclonal Antibody
TA422641 100 µL

WASF2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Uncoated Human RBP4 (Retinol Binding Protein 4) ELISA Kit
E-UNEL-H0232-01 5x 96 Tests

Uncoated Human RBP4 (Retinol Binding Protein 4) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human RBP4 (Retinol Binding Protein 4) ELISA Kit
E-UNEL-H0232-02 15x 96 Tests

Uncoated Human RBP4 (Retinol Binding Protein 4) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Protocadherin-10/PCDH10 Protein (Fc Tag)
PKSH032979-01 10 µg

Recombinant Human Protocadherin-10/PCDH10 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human Protocadherin-10/PCDH10 Protein (Fc Tag)
PKSH032979-02 50 µg

Recombinant Human Protocadherin-10/PCDH10 Protein (Fc Tag)

Sign In for Pricing
View Details
MMP9 (Matrix Metalloproteinase 9) (2C3), CF740 conjugate, 0.1mg/mL
BNC741764-500 1x 500 µL

MMP9 (Matrix Metalloproteinase 9) (2C3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details