Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tetraspanin-18 (Tspan18)

This Recombinant Mouse Tetraspanin-18 (Tspan18) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

Tetraspanin-18, Tspan-18

UniProt

Q80WR1

Expression Region

1-248

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGDCLSCMKYLMFVFNFFVFLGGACLLGVGIWVLVDPTGFREIVATNPLLTTGAYIVLA MGGLLFLLGFLGCCGAVRENRCLLLFFFLFILIIFLVELSAAILAFIFREHLTREFFTKE LTKHYQGDNDTDVFSATWNSVMITFGCCGVNGPEDFKLASVFRLLTLDTEEVPKACCRRE PQTRDGVVLSREECQLGRNPFINKQGCYTVILNTFETYVYLAGAFAIGVLAIELFLMVFA MCLFRGIQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIGLEC11 (NM_052884) Human Over-expression Lysate
LC432355 20 µg

SIGLEC11 (NM_052884) Human Over-expression Lysate

Sign In for Pricing
View Details
CLPTM1 Rabbit Monoclonal Antibody [Clone ID: 23GB3090]
TA424664 100 µL

CLPTM1 Rabbit Monoclonal Antibody [Clone ID: 23GB3090]

Sign In for Pricing
View Details
Human IL-33 (Interleukin 33) CLIA Kit
E-CL-H1407-01 24 Tests

Human IL-33 (Interleukin 33) CLIA Kit

Sign In for Pricing
View Details
Human IL-33 (Interleukin 33) CLIA Kit
E-CL-H1407-02 48 Tests

Human IL-33 (Interleukin 33) CLIA Kit

Sign In for Pricing
View Details
Human IL-33 (Interleukin 33) CLIA Kit
E-CL-H1407-03 96 Tests

Human IL-33 (Interleukin 33) CLIA Kit

Sign In for Pricing
View Details
TGN46 Recombinant Rabbit Monoclonal Antibody [JF1-024]
ET1702-56 100 µL

TGN46 Recombinant Rabbit Monoclonal Antibody [JF1-024]

Sign In for Pricing
View Details