Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tetraspanin-18 (Tspan18)

This Recombinant Mouse Tetraspanin-18 (Tspan18) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

Tetraspanin-18, Tspan-18

UniProt

Q80WR1

Expression Region

1-248

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGDCLSCMKYLMFVFNFFVFLGGACLLGVGIWVLVDPTGFREIVATNPLLTTGAYIVLA MGGLLFLLGFLGCCGAVRENRCLLLFFFLFILIIFLVELSAAILAFIFREHLTREFFTKE LTKHYQGDNDTDVFSATWNSVMITFGCCGVNGPEDFKLASVFRLLTLDTEEVPKACCRRE PQTRDGVVLSREECQLGRNPFINKQGCYTVILNTFETYVYLAGAFAIGVLAIELFLMVFA MCLFRGIQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Phenyl-1,2-benzoselenazol-3-one (Ebselen)
TRC-P319510-25MG 25 mg

2-Phenyl-1,2-benzoselenazol-3-one (Ebselen)

Sign In for Pricing
View Details
HPV16 E1/E4 (Human Papilloma Virus 16) (HPV16 E1/E4), CF647 conjugate, 0.1mg/mL
BNC473066-100 1x 100 µL

HPV16 E1/E4 (Human Papilloma Virus 16) (HPV16 E1/E4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human NIP7/KD93 Protein (His Tag)
PKSH032811-01 10 µg

Recombinant Human NIP7/KD93 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human NIP7/KD93 Protein (His Tag)
PKSH032811-02 50 µg

Recombinant Human NIP7/KD93 Protein (His Tag)

Sign In for Pricing
View Details
(R,S)-Anatabine
TRC-A637500-50MG 50 mg

(R,S)-Anatabine

Sign In for Pricing
View Details
KLF6 Rabbit Polyclonal Antibody
TA373071 100 µL

KLF6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details