Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anthoceros formosae ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Anthoceros formosae ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

Q85AE6

Expression Region

1-248

Origin

Anthoceros formosae (Hornwort)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYSAQSSISKLTNLCEISSVEVGQHFYWQIGGFQVHAQVLITSWIVIAILLGLAILATQN LQTIPTSGQNFVEYILEFIRDLTRTQIGEEEYRPWVPFIGTMFLFIFVSNWSGALLPWRI FELPHGELAAPTNDINTTVALALPTSVAYFYAGLRKKGLSYSGKYIQPTPILLPINILED FTKPLPLSFRLFGNILADELVVAVPISLVPLVVPIPMMFLGLFTSAIQALIFATLAAAYI GESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Chn2 ELISA Kit
ELI-25633r 96 Tests

Rat Chn2 ELISA Kit

Sign In for Pricing
View Details
TRPM2 Antibody
A37571-100UL 100 µL

TRPM2 Antibody

Sign In for Pricing
View Details
MALT1 (NM_173844) Human Over-expression Lysate
LY406281 100 µg

MALT1 (NM_173844) Human Over-expression Lysate

Sign In for Pricing
View Details
ACTA1 Polyclonal Antibody, Biotin Conjugated
A54417-100 100 µL

ACTA1 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
CCDC109B Recombinant Protein (Mouse)
RP121526 100 µg

CCDC109B Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Phospho-CBL (Tyr700) Rabbit Polyclonal Antibody (PE)
orb504786 100 µL

Phospho-CBL (Tyr700) Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details