Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anthoceros formosae ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Anthoceros formosae ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

Q85AE6

Expression Region

1-248

Origin

Anthoceros formosae (Hornwort)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYSAQSSISKLTNLCEISSVEVGQHFYWQIGGFQVHAQVLITSWIVIAILLGLAILATQN LQTIPTSGQNFVEYILEFIRDLTRTQIGEEEYRPWVPFIGTMFLFIFVSNWSGALLPWRI FELPHGELAAPTNDINTTVALALPTSVAYFYAGLRKKGLSYSGKYIQPTPILLPINILED FTKPLPLSFRLFGNILADELVVAVPISLVPLVVPIPMMFLGLFTSAIQALIFATLAAAYI GESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFT140 Knockout HGC-27 Polyclonal Cells
ARG30005 1 Million

IFT140 Knockout HGC-27 Polyclonal Cells

Sign In for Pricing
View Details
CAPZB (F-actin-capping Protein Subunit beta, CapZ beta)
MBS645354-01 0.05 mg

CAPZB (F-actin-capping Protein Subunit beta, CapZ beta)

Sign In for Pricing
View Details
CAPZB (F-actin-capping Protein Subunit beta, CapZ beta)
MBS645354-02 5x 0.05 mg

CAPZB (F-actin-capping Protein Subunit beta, CapZ beta)

Sign In for Pricing
View Details
STC1 Antibody
A35813-100UL 100 µL

STC1 Antibody

Sign In for Pricing
View Details
Cadmium (II) telluride
IN1372 1 Each

Cadmium (II) telluride

Sign In for Pricing
View Details
Tdrd3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4944008 1.0 µg DNA

Tdrd3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details