Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anthoceros formosae ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Anthoceros formosae ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

Q85AE6

Expression Region

1-248

Origin

Anthoceros formosae (Hornwort)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYSAQSSISKLTNLCEISSVEVGQHFYWQIGGFQVHAQVLITSWIVIAILLGLAILATQN LQTIPTSGQNFVEYILEFIRDLTRTQIGEEEYRPWVPFIGTMFLFIFVSNWSGALLPWRI FELPHGELAAPTNDINTTVALALPTSVAYFYAGLRKKGLSYSGKYIQPTPILLPINILED FTKPLPLSFRLFGNILADELVVAVPISLVPLVVPIPMMFLGLFTSAIQALIFATLAAAYI GESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZSCAN21 Protein Vector (Mouse) (pPM-C-HA)
PV251112 500 ng

ZSCAN21 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Peroxiredoxin-6 Recombinant Antibody, Cy7 Conjugated
bsm-61449R-Cy7-01 20 µL

Peroxiredoxin-6 Recombinant Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Peroxiredoxin-6 Recombinant Antibody, Cy7 Conjugated
bsm-61449R-Cy7-02 100 µL

Peroxiredoxin-6 Recombinant Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
KAP3 siRNA (m)
sc-40722 10 µM

KAP3 siRNA (m)

Sign In for Pricing
View Details
Recombinant Human Polymerase (RNA) II (DNA directed) Polypeptide H
32-4478-20 20 µg

Recombinant Human Polymerase (RNA) II (DNA directed) Polypeptide H

Sign In for Pricing
View Details
Human HTR7 shRNA Plasmid
abx952293-01 150 µg

Human HTR7 shRNA Plasmid

Sign In for Pricing
View Details