Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein traX (traX)

This Recombinant Protein traX (traX) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

Protein traX

UniProt

P22710

Expression Region

1-248

Origin

Escherichia coli

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTDNTNTTRNDSLAARTDTWLQSFLVWSPGQRDIIKTVALVLMVLDHINLIFQLKQEWM FLAGRGAFPLFALVWGLNLSRHAHIRQPAINRLWGWGIIAQFAYYLAGFPWYEGNILFAF AVAAQVLTWCETRSGWRTAAAILLMALWGPLSGTSYGIAGLLMLAVSYRLYRAEDRAERL ALLACLLAVIPALNLASSDAAAVAGLVMTVLTVGLVSCAGKSLPRFWPGDFFPVFYACHL AVLGVLAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPAG1 Double Nickase Plasmid (h)
sc-409688-NIC 20 µg

SPAG1 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Lentiviral human CCR5 shRNA (UAS) - Lentiviral human CCR5 shRNA (UAS, RFP) plasmid
GTR15327052 1 Vial

Lentiviral human CCR5 shRNA (UAS) - Lentiviral human CCR5 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces Pombe mug86 Protein (aa 1-304)
VAng-Yyj5722-inquire Inquire

Recombinant Schizosaccharomyces Pombe mug86 Protein (aa 1-304)

Sign In for Pricing
View Details
Frg1 sgRNA CRISPR Lentivector set (Mouse)
K3421901 3x 1.0 µg

Frg1 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Scin sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3378707 1.0 µg DNA

Scin sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
CER1 cDNA Clone
MBS1271620-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

CER1 cDNA Clone

Sign In for Pricing
View Details