Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein traX (traX)

This Recombinant Protein traX (traX) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

Protein traX

UniProt

P22710

Expression Region

1-248

Origin

Escherichia coli

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTDNTNTTRNDSLAARTDTWLQSFLVWSPGQRDIIKTVALVLMVLDHINLIFQLKQEWM FLAGRGAFPLFALVWGLNLSRHAHIRQPAINRLWGWGIIAQFAYYLAGFPWYEGNILFAF AVAAQVLTWCETRSGWRTAAAILLMALWGPLSGTSYGIAGLLMLAVSYRLYRAEDRAERL ALLACLLAVIPALNLASSDAAAVAGLVMTVLTVGLVSCAGKSLPRFWPGDFFPVFYACHL AVLGVLAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAM32 (4H9) Alexa Fluor® 594
sc-130559 AF594 200 µg/mL

BAM32 (4H9) Alexa Fluor® 594

Sign In for Pricing
View Details
Polyclonal Antibody to Connexin 43 (CX43)
TRV-0056017-01 20 µL

Polyclonal Antibody to Connexin 43 (CX43)

Sign In for Pricing
View Details
Polyclonal Antibody to Connexin 43 (CX43)
TRV-0056017-02 100 µL

Polyclonal Antibody to Connexin 43 (CX43)

Sign In for Pricing
View Details
Polyclonal Antibody to Connexin 43 (CX43)
TRV-0056017-03 200 µL

Polyclonal Antibody to Connexin 43 (CX43)

Sign In for Pricing
View Details
Polyclonal Antibody to Connexin 43 (CX43)
TRV-0056017-04 1 mL

Polyclonal Antibody to Connexin 43 (CX43)

Sign In for Pricing
View Details
TY2A-DR3 Antibody
orb850045 2 mg

TY2A-DR3 Antibody

Sign In for Pricing
View Details