Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium bovis Cobalamin synthase (cobS)

This Recombinant Mycobacterium bovis Cobalamin synthase (cobS) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A1KKQ0

Expression Region

1-249

Origin

Mycobacterium bovis (strain BCG / Pasteur 1173P2)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRSLATAFAFATVIPTPGSATTPMGRGPMTALPVVGAALGALAAAIAWAGAQVFGPSSP LSGMLTVAVLLVVTRGLHIDGVADTADGLGCYGPPQRALAVMRDGSTGPFGVAAVVLVIA LQGLAFATLTTVGIAGITLAVLSGRVTAVLVCRRSVPAAHGSTLGSRVAGTQPAPVVAAW LAVLLAVSVPAGPRPWQGPIAVLVAVTAGAALAAHCVHRFGGVTGDVLGSAIELSTTVSA VTLAGLARL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ISO 7981-2, PAH Standard Solution, 6 components
F868391 1 mL

ISO 7981-2, PAH Standard Solution, 6 components

Sign In for Pricing
View Details
Ttc9 sgRNA CRISPR Lentivector set (Rat)
K6051501 3x 1.0 µg

Ttc9 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
3,4-Dimethoxycinnamic acid
S9341-25mg 25 mg

3,4-Dimethoxycinnamic acid

Sign In for Pricing
View Details
Purified Anti-Human/Monkey CD154 Antibody
RD21619F-01 25 µg

Purified Anti-Human/Monkey CD154 Antibody

Sign In for Pricing
View Details
Purified Anti-Human/Monkey CD154 Antibody
RD21619F-02 100 µg

Purified Anti-Human/Monkey CD154 Antibody

Sign In for Pricing
View Details
C21orf34 (NM_001005732) Human Tagged Lenti ORF Clone
RC214939L1 10 µg

C21orf34 (NM_001005732) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details