Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium bovis Cobalamin synthase (cobS)

This Recombinant Mycobacterium bovis Cobalamin synthase (cobS) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A1KKQ0

Expression Region

1-249

Origin

Mycobacterium bovis (strain BCG / Pasteur 1173P2)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRSLATAFAFATVIPTPGSATTPMGRGPMTALPVVGAALGALAAAIAWAGAQVFGPSSP LSGMLTVAVLLVVTRGLHIDGVADTADGLGCYGPPQRALAVMRDGSTGPFGVAAVVLVIA LQGLAFATLTTVGIAGITLAVLSGRVTAVLVCRRSVPAAHGSTLGSRVAGTQPAPVVAAW LAVLLAVSVPAGPRPWQGPIAVLVAVTAGAALAAHCVHRFGGVTGDVLGSAIELSTTVSA VTLAGLARL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

anti-Human TSH beta Antibody
MBS5317101-01 1 mg

anti-Human TSH beta Antibody

Sign In for Pricing
View Details
anti-Human TSH beta Antibody
MBS5317101-02 5x 1 mg

anti-Human TSH beta Antibody

Sign In for Pricing
View Details
Rpusd1 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6421002 1.0 µg DNA

Rpusd1 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Rabbit anti-Alpha-tubulin (AcK352) Antibody
MBS4511947-01 0.05 mL

Rabbit anti-Alpha-tubulin (AcK352) Antibody

Sign In for Pricing
View Details
Rabbit anti-Alpha-tubulin (AcK352) Antibody
MBS4511947-02 0.1 mL

Rabbit anti-Alpha-tubulin (AcK352) Antibody

Sign In for Pricing
View Details
Rabbit anti-Alpha-tubulin (AcK352) Antibody
MBS4511947-03 5x 0.1 mL

Rabbit anti-Alpha-tubulin (AcK352) Antibody

Sign In for Pricing
View Details