Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium bovis Cobalamin synthase (cobS)

This Recombinant Mycobacterium bovis Cobalamin synthase (cobS) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A1KKQ0

Expression Region

1-249

Origin

Mycobacterium bovis (strain BCG / Pasteur 1173P2)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRSLATAFAFATVIPTPGSATTPMGRGPMTALPVVGAALGALAAAIAWAGAQVFGPSSP LSGMLTVAVLLVVTRGLHIDGVADTADGLGCYGPPQRALAVMRDGSTGPFGVAAVVLVIA LQGLAFATLTTVGIAGITLAVLSGRVTAVLVCRRSVPAAHGSTLGSRVAGTQPAPVVAAW LAVLLAVSVPAGPRPWQGPIAVLVAVTAGAALAAHCVHRFGGVTGDVLGSAIELSTTVSA VTLAGLARL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRS2 Rabbit Monoclonal Antibody
TA423139 100 µL

FRS2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Influenza A virus Polymerase basic protein 2 (PB2), partial
MBS1153776 Inquire

Recombinant Influenza A virus Polymerase basic protein 2 (PB2), partial

Sign In for Pricing
View Details
CPSF3L Protein Vector (Human) (pPM-C-His)
PV010544 500 ng

CPSF3L Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Mouse CD44 Differentiation Reporter (pGreenZeo, Virus)
SR10020VA-1 > 2x 10^6 IFUs

Mouse CD44 Differentiation Reporter (pGreenZeo, Virus)

Sign In for Pricing
View Details
EAAT1 Antibody
R12-2120-01 50 μL

EAAT1 Antibody

Sign In for Pricing
View Details
EAAT1 Antibody
R12-2120-02 100 µL

EAAT1 Antibody

Sign In for Pricing
View Details