Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lepidium virginicum ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Lepidium virginicum ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

A4QL94

Expression Region

1-249

Origin

Lepidium virginicum (Virginia pepperweed)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVLSCSINTLIKEGLYEISGVEVGQHFYWQIGGFQVHAQVLITSWVVIAILLGSAVLAI RNPQTIPTDGQNFFEFVLEFIRDVSQTQIGEEYGPWVPFIGTLFLFIFVSNWSGALLPWK IIQLPQGELAAPTNDINTTVALALLTSVAYFYAGLSKKGLGYFSKYIQPTPILLPINILE DFTKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAY IGESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine7 Anti-Human CD4 Antibody[SK3]
E-AB-F1352H-01 20 Tests

PE/Cyanine7 Anti-Human CD4 Antibody[SK3]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD4 Antibody[SK3]
E-AB-F1352H-02 100 Tests

PE/Cyanine7 Anti-Human CD4 Antibody[SK3]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD4 Antibody[SK3]
E-AB-F1352H-03 2x 100 Tests

PE/Cyanine7 Anti-Human CD4 Antibody[SK3]

Sign In for Pricing
View Details
TCL1 (T-Cell Marker) (TCL1/2079), CF568 conjugate, 0.1mg/mL
BNC682079-500 1x 500 µL

TCL1 (T-Cell Marker) (TCL1/2079), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AsuHPI, 100U
RE1134 100 U

AsuHPI, 100U

Sign In for Pricing
View Details
Granulocyte Marker (BM-2), CF647 conjugate, 0.1mg/mL
BNC470062-100 1x 100 µL

Granulocyte Marker (BM-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details