Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lepidium virginicum ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Lepidium virginicum ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

A4QL94

Expression Region

1-249

Origin

Lepidium virginicum (Virginia pepperweed)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVLSCSINTLIKEGLYEISGVEVGQHFYWQIGGFQVHAQVLITSWVVIAILLGSAVLAI RNPQTIPTDGQNFFEFVLEFIRDVSQTQIGEEYGPWVPFIGTLFLFIFVSNWSGALLPWK IIQLPQGELAAPTNDINTTVALALLTSVAYFYAGLSKKGLGYFSKYIQPTPILLPINILE DFTKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAY IGESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PD-L1 (CD274) Mouse Monoclonal Antibody [Clone ID: OTI2F5]
CF812583 100 µg

PD-L1 (CD274) Mouse Monoclonal Antibody [Clone ID: OTI2F5]

Sign In for Pricing
View Details
LOC285033 (NM_001037228) Human Recombinant Protein
TP310999M 100 µg

LOC285033 (NM_001037228) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS703866 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
EIF1 Polyclonal Antibody
E-AB-90246-01 60 µL

EIF1 Polyclonal Antibody

Sign In for Pricing
View Details
EIF1 Polyclonal Antibody
E-AB-90246-02 120 µL

EIF1 Polyclonal Antibody

Sign In for Pricing
View Details
EIF1 Polyclonal Antibody
E-AB-90246-03 200 µL

EIF1 Polyclonal Antibody

Sign In for Pricing
View Details