Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lepidium virginicum ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Lepidium virginicum ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

A4QL94

Expression Region

1-249

Origin

Lepidium virginicum (Virginia pepperweed)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVLSCSINTLIKEGLYEISGVEVGQHFYWQIGGFQVHAQVLITSWVVIAILLGSAVLAI RNPQTIPTDGQNFFEFVLEFIRDVSQTQIGEEYGPWVPFIGTLFLFIFVSNWSGALLPWK IIQLPQGELAAPTNDINTTVALALLTSVAYFYAGLSKKGLGYFSKYIQPTPILLPINILE DFTKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAY IGESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GM CSF (CSF2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6A3]
TA807985AM 100 µL

GM CSF (CSF2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6A3]

Sign In for Pricing
View Details
Tissue Protein Lysate, Lung
CP565445 150 µg

Tissue Protein Lysate, Lung

Sign In for Pricing
View Details
UMODL1 Human Gene Knockout Kit (CRISPR)
KN415569 1 Kit

UMODL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MED8 (NM_001001654) Human Over-expression Lysate
LY424404 100 µg

MED8 (NM_001001654) Human Over-expression Lysate

Sign In for Pricing
View Details
CERKL (NM_001030312) Human Over-expression Lysate
LY422210 100 µg

CERKL (NM_001030312) Human Over-expression Lysate

Sign In for Pricing
View Details
Tsen2 Mouse Gene Knockout Kit (CRISPR)
KN518327 1 Kit

Tsen2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details