Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis Cobalamin synthase (cobS)

This Recombinant Mycobacterium tuberculosis Cobalamin synthase (cobS) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A5U4N6

Expression Region

1-249

Origin

Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRSLATAFAFATVIPTPGSATTPMGRGPMTALPVVGAALGALAAAIAWAGAQVFGPSSP LSGMLTVAVLLVVTRGLHIDGVADTADGLGCYGPPQRALAVMRDGSTGPFGVAAVVLVIA LQGLAFATLTTVGIAGITLAVLSGRVTAVLVCRRLVPAAHGSTLGSRVAGTQPAPVVAAW LAVLLAVSVPAGPRPWQGPIAVLVAVTAGAALAAHCVHRFGGVTGDVLGSAIELSTTVSA VTLAGLARL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1700029F12Rik Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
10212064 1.0 µg DNA

1700029F12Rik Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
POU5F1P6 CRISPR All-in-one AAV vector set (with saCas9)(Human)
37274151 3x 1.0 µg DNA

POU5F1P6 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Protein Phosphatase 1, Regulatory Subunit 15A (PPP1R15A)
MBS2063946-01 0.1 mL

FITC-Linked Polyclonal Antibody to Protein Phosphatase 1, Regulatory Subunit 15A (PPP1R15A)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Protein Phosphatase 1, Regulatory Subunit 15A (PPP1R15A)
MBS2063946-02 0.2 mL

FITC-Linked Polyclonal Antibody to Protein Phosphatase 1, Regulatory Subunit 15A (PPP1R15A)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Protein Phosphatase 1, Regulatory Subunit 15A (PPP1R15A)
MBS2063946-03 0.5 mL

FITC-Linked Polyclonal Antibody to Protein Phosphatase 1, Regulatory Subunit 15A (PPP1R15A)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Protein Phosphatase 1, Regulatory Subunit 15A (PPP1R15A)
MBS2063946-04 1 mL

FITC-Linked Polyclonal Antibody to Protein Phosphatase 1, Regulatory Subunit 15A (PPP1R15A)

Sign In for Pricing
View Details