Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis Cobalamin synthase (cobS)

This Recombinant Mycobacterium tuberculosis Cobalamin synthase (cobS) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A5U4N6

Expression Region

1-249

Origin

Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRSLATAFAFATVIPTPGSATTPMGRGPMTALPVVGAALGALAAAIAWAGAQVFGPSSP LSGMLTVAVLLVVTRGLHIDGVADTADGLGCYGPPQRALAVMRDGSTGPFGVAAVVLVIA LQGLAFATLTTVGIAGITLAVLSGRVTAVLVCRRLVPAAHGSTLGSRVAGTQPAPVVAAW LAVLLAVSVPAGPRPWQGPIAVLVAVTAGAALAAHCVHRFGGVTGDVLGSAIELSTTVSA VTLAGLARL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (16.3A5, 1F5, CD59a, EJ16, EJ30, EL32, FLJ38134, FLJ92039, G344, 20kD Homologous Restriction Factor, HRF20, HRF-20, Human Leukocyte Antigen MIC11, Ly-6-like Protein, Lymphocytic Antigen CD59/MEM43, MAC Inhibitory Protein, MAC-IP, MEM43 Antigen, Membr
MBS6249693-01 0.1 mL

CD59 (16.3A5, 1F5, CD59a, EJ16, EJ30, EL32, FLJ38134, FLJ92039, G344, 20kD Homologous Restriction Factor, HRF20, HRF-20, Human Leukocyte Antigen MIC11, Ly-6-like Protein, Lymphocytic Antigen CD59/MEM43, MAC Inhibitory Protein, MAC-IP, MEM43 Antigen, Membr

Sign In for Pricing
View Details
CD59 (16.3A5, 1F5, CD59a, EJ16, EJ30, EL32, FLJ38134, FLJ92039, G344, 20kD Homologous Restriction Factor, HRF20, HRF-20, Human Leukocyte Antigen MIC11, Ly-6-like Protein, Lymphocytic Antigen CD59/MEM43, MAC Inhibitory Protein, MAC-IP, MEM43 Antigen, Membr
MBS6249693-02 5x 0.1 mL

CD59 (16.3A5, 1F5, CD59a, EJ16, EJ30, EL32, FLJ38134, FLJ92039, G344, 20kD Homologous Restriction Factor, HRF20, HRF-20, Human Leukocyte Antigen MIC11, Ly-6-like Protein, Lymphocytic Antigen CD59/MEM43, MAC Inhibitory Protein, MAC-IP, MEM43 Antigen, Membr

Sign In for Pricing
View Details
Mouse Monoclonal GPD1L Antibody (14E2) [Janelia Fluor 646]
NBP2-59439JF646 0.1 mL

Mouse Monoclonal GPD1L Antibody (14E2) [Janelia Fluor 646]

Sign In for Pricing
View Details
NEU2 Protein Vector (Mouse) (pPB-C-His)
PV204978 500 ng

NEU2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Thymidine phosphorylase
orb1645171-01 50 µg

Thymidine phosphorylase

Sign In for Pricing
View Details
Thymidine phosphorylase
orb1645171-02 100 µg

Thymidine phosphorylase

Sign In for Pricing
View Details