Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Trichodesmium erythraeum ATP synthase subunit a (atpB)

This Recombinant Trichodesmium erythraeum ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q112Z1

Expression Region

1-249

Origin

Trichodesmium erythraeum (strain IMS101)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLDVLNTINFLPLAELEVGQHFYWELGSFKIHGQILLTSWFVIALILLAAFISSLNVQRI PSGMQNFMESVLEFIRSLTKDQIGEKDYRPWVPFIGTLFLFIFVSNWSGALVPWKVIELP SGELAAPTSDINTTVALALLTSIAYFYAGISKKGLGYFAGYAEPVPFMVPFKIIEDFTKP LSLSFRLFGNILADELVVGVLVLLVPLFIPLPLMVLGLFLSAIQALIFATLAANYIGEAL EEHGAEDHD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hygromycin B
TRC-H997600-5G 5 g

Hygromycin B

Sign In for Pricing
View Details
C16orf88 (KNOP1) (NM_001012991) Human Over-expression Lysate
LY422950 100 µg

C16orf88 (KNOP1) (NM_001012991) Human Over-expression Lysate

Sign In for Pricing
View Details
Human SLC35F1 activation kit by CRISPRa
GA116673 1 Kit

Human SLC35F1 activation kit by CRISPRa

Sign In for Pricing
View Details
PSA (Prostate Specific Antigen) (A67-B/E3), CF568 conjugate, 0.1mg/mL
BNC680883-500 1x 500 µL

PSA (Prostate Specific Antigen) (A67-B/E3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SV2A Antibody
KC-8337-01 50 μL

SV2A Antibody

Sign In for Pricing
View Details
SV2A Antibody
KC-8337-02 100 µL

SV2A Antibody

Sign In for Pricing
View Details