Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Trichodesmium erythraeum ATP synthase subunit a (atpB)

This Recombinant Trichodesmium erythraeum ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q112Z1

Expression Region

1-249

Origin

Trichodesmium erythraeum (strain IMS101)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLDVLNTINFLPLAELEVGQHFYWELGSFKIHGQILLTSWFVIALILLAAFISSLNVQRI PSGMQNFMESVLEFIRSLTKDQIGEKDYRPWVPFIGTLFLFIFVSNWSGALVPWKVIELP SGELAAPTSDINTTVALALLTSIAYFYAGISKKGLGYFAGYAEPVPFMVPFKIIEDFTKP LSLSFRLFGNILADELVVGVLVLLVPLFIPLPLMVLGLFLSAIQALIFATLAANYIGEAL EEHGAEDHD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMAD1 pSer465 Rabbit Polyclonal Antibody
AP08024PU-N 100 µL

SMAD1 pSer465 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Homoglutathione H-Glu(Cys-Beta-Ala-OH)-OH TFA Salt
TRC-H593508-5MG 5 mg

Homoglutathione H-Glu(Cys-Beta-Ala-OH)-OH TFA Salt

Sign In for Pricing
View Details
CACNG1 Rabbit Polyclonal Antibody
TA374198 100 µL

CACNG1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Prostate Specific Acid Phosphatase (PSAP) (PASE/4LJ), CF488A conjugate, 0.1mg/mL
BNC881473-100 1x 100 µL

Prostate Specific Acid Phosphatase (PSAP) (PASE/4LJ), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS804822 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
Fexofenadine
TRC-F322470-50MG 50 mg

Fexofenadine

Sign In for Pricing
View Details