Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorokybus atmophyticus ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Chlorokybus atmophyticus ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

Q19VA2

Expression Region

1-249

Origin

Chlorokybus atmophyticus (Soil alga)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYSLNPSQIEASNLLYQVSSVEVGKHLYWQLGMFQVHGQVLITSWVVMAIIIITSVIASR NLQPIPSGTQNFLEYVLEFIRDLTKTQVGEEEYRSWVPFVGTLFLFIFISNWSGALIPWR LIELPSGELAAPTNDINTTVALALLTSVAYFYAGLSKKGLSYFGKYIQPTPILLPINILE DFTKPLSLSFRLFGNILADELVVAVLISLVPLVIPVPMMLLGLFTSGIQALIFATLAAAY IGESLEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
BNC740669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF488A conjugate, 0.1mg/mL
BNC880039-100 1x 100 µL

CD34 (ICO-115), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL
BNC881050-500 1x 500 µL

CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF647 conjugate, 0.1mg/mL
BNC470050-100 1x 100 µL

IgA Secretory Component (SC05), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL
BNC470352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Beta-2 Microglobulin (Renal Failure & Tumor Marker) (B2M/1857R), CF640R conjugate, 0.1mg/mL
BNC401857-500 1x 500 µL

Beta-2 Microglobulin (Renal Failure & Tumor Marker) (B2M/1857R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details