Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus elongatus ATP synthase subunit a (atpB)

This Recombinant Synechococcus elongatus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q31RF6

Expression Region

1-249

Origin

Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPTLLELSSVLPLAELEVGQHFYWQIGNYRLHGQVFLTSWFVIAALVVLSLLANRNLQRI PSGLQNFMEYVLDFIRNLARTQIGEKEYRPWVPFIGTLFLFIFLSNWSGALIPWKLIKLP SGELAAPTSDINTTVALALLTSLAYFYAGFSRKGLGYFGNYVHPTPVMLPFKILEDFTKP LSLSFRLFGNILADELVVAVLVLLVPLFVPLPAMILGLFTSAIQALIFATLAASYIGEAV EEHGEEHAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLF7 Mouse Monoclonal Antibody [Clone ID: OTI8D7]
CF812009 100 µg

KLF7 Mouse Monoclonal Antibody [Clone ID: OTI8D7]

Sign In for Pricing
View Details
DLX4 (NM_138281) Human Recombinant Protein
TP760063 50 µg

DLX4 (NM_138281) Human Recombinant Protein

Sign In for Pricing
View Details
Coelenterazine H
#10111 1x 50 µg

Coelenterazine H

Sign In for Pricing
View Details
T Mouse Gene Knockout Kit (CRISPR)
KN517100 1 Kit

T Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GSK3 beta (GSK3B) Human Gene Knockout Kit (CRISPR)
KN200468LP 1 Kit

GSK3 beta (GSK3B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant MERS-CoV Nucleocapsid Protein
PKSV030288-01 50 µg

Recombinant MERS-CoV Nucleocapsid Protein

Sign In for Pricing
View Details