Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zea mays Derlin-2.2 (DER2.2)

This Recombinant Zea mays Derlin-2.2 (DER2.2) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

Derlin-2.2, ZmDerlin2-2

UniProt

Q4G2J3

Expression Region

1-249

Origin

Zea mays (Maize)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQAVEEWYRQMPIITRSYLTAAVVTTVGCTLEIISPYHLYLNPKLVVQHYEIWRLVTNF LYFRKMDLDFLFHMFFLARYCKLLEENSFRGRTADFFYMLLFGATVLTGIVLIGGMIPYI SETFARILFLSNSLTFMMVYVWSKHNPFIHMSFLGLFTFTAAYLPWVLLGFSILVGSSTW VDLLGMIAGHVYYFLEDVYPRMTGRRPLKTPSFIKALFADDNVVVAQPPNAGIGAGARFG AIGVDPQAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RASGEF1B Human Gene Knockout Kit (CRISPR)
KN420177 1 Kit

RASGEF1B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human CIB4 activation kit by CRISPRa
GA115103 1 Kit

Human CIB4 activation kit by CRISPRa

Sign In for Pricing
View Details
Sudan Orange G
TRC-S688925-1G 1 g

Sudan Orange G

Sign In for Pricing
View Details
PTau202/205 Antibody
KC-45140-01 50 μL

PTau202/205 Antibody

Sign In for Pricing
View Details
PTau202/205 Antibody
KC-45140-02 100 µL

PTau202/205 Antibody

Sign In for Pricing
View Details
PTau202/205 Antibody
KC-45140-03 1 mL

PTau202/205 Antibody

Sign In for Pricing
View Details