Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zea mays Derlin-2.2 (DER2.2)

This Recombinant Zea mays Derlin-2.2 (DER2.2) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

Derlin-2.2, ZmDerlin2-2

UniProt

Q4G2J3

Expression Region

1-249

Origin

Zea mays (Maize)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQAVEEWYRQMPIITRSYLTAAVVTTVGCTLEIISPYHLYLNPKLVVQHYEIWRLVTNF LYFRKMDLDFLFHMFFLARYCKLLEENSFRGRTADFFYMLLFGATVLTGIVLIGGMIPYI SETFARILFLSNSLTFMMVYVWSKHNPFIHMSFLGLFTFTAAYLPWVLLGFSILVGSSTW VDLLGMIAGHVYYFLEDVYPRMTGRRPLKTPSFIKALFADDNVVVAQPPNAGIGAGARFG AIGVDPQAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C16orf42 (TSR3) (NM_001001410) Human Over-expression Lysate
LY424339 100 µg

C16orf42 (TSR3) (NM_001001410) Human Over-expression Lysate

Sign In for Pricing
View Details
GPSN2 Antibody
8C18998-AAT 50 µg

GPSN2 Antibody

Sign In for Pricing
View Details
Human C16orf87 activation kit by CRISPRa
GA117935 1 Kit

Human C16orf87 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS626749 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Human MMP13, C-His, Flag Tag
HA210854-01 20 µg

Human MMP13, C-His, Flag Tag

Sign In for Pricing
View Details
Human MMP13, C-His, Flag Tag
HA210854-02 50 µg

Human MMP13, C-His, Flag Tag

Sign In for Pricing
View Details